PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000290934
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family bHLH
Protein Properties Length: 194aa    MW: 22345.3 Da    PI: 9.6133
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000290934genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH31.63e-101663554
                   HHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
            HLH  5 hnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                      +E++RR+r++  +++L +llPk+  + ++ ls  +   +A++YIks 
  MDP0000290934 16 RRVVEKNRRNRMKLLYSNLYSLLPKQ--TFKEPLSQTDQIDEAINYIKSQ 63
                   5679*********************7..59999***************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474593.01E-11980IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.6521163IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.107.1E-91481IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000109.2E-71762IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd048730.00444127177No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MDRNHANESS STKVERRVVE KNRRNRMKLL YSNLYSLLPK QTFKEPLSQT DQIDEAINYI  60
KSQESNLQKL KEKKESLMRT RKRSYATACV NVESTRSAKA PHIKIHEIDS TLEVVLISGL  120
ENHQFMFYDI IRLLDEEHAN VVHANFSTLG DSTFHIVRAE IGKSISEFGA ARITEKLNRF  180
VNGSTSDQES RLMS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.143934e-75leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008353778.11e-142PREDICTED: transcription factor bHLH118-like isoform X3
TrEMBLM5VT394e-90M5VT39_PRUPE; Uncharacterized protein
STRINGPOPTR_0019s13090.12e-61(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9063498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G20970.12e-28bHLH family protein